Class a: All alpha proteins [46456] (226 folds) |
Fold a.26: 4-helical cytokines [47265] (1 superfamily) core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections |
Superfamily a.26.1: 4-helical cytokines [47266] (3 families) there are two different topoisomers of this fold with different entanglements of the two crossover connections |
Family a.26.1.2: Short-chain cytokines [47286] (11 proteins) |
Protein Interleukin-4 (IL-4) [47291] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [47292] (13 PDB entries) |
Domain d1cyl__: 1cyl - [16860] |
PDB Entry: 1cyl (more details)
SCOP Domain Sequences for d1cyl__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cyl__ a.26.1.2 (-) Interleukin-4 (IL-4) {Human (Homo sapiens)} hkcditlqeiiktlnslteqktlcteltvtdifaaskntteketfcraatvlrqfyshhe kdtrclgataqqfhrhkqlirflkrldrnlwglaglnscpvkeanqstlenflerlktim rekyskcss
Timeline for d1cyl__: