Lineage for d2vgpb_ (2vgp B:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1929110Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 1929111Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 1929232Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 1931583Protein automated matches [190091] (12 species)
    not a true protein
  7. 1931584Species African clawed frog (Xenopus laevis) [TaxId:8355] [187456] (9 PDB entries)
  8. 1931589Domain d2vgpb_: 2vgp B: [168591]
    automated match to d1ol5a_
    complexed with ad6

Details for d2vgpb_

PDB Entry: 2vgp (more details), 1.7 Å

PDB Description: crystal structure of aurora b kinase in complex with a aminothiazole inhibitor
PDB Compounds: (B:) serine/threonine-protein kinase 12-a

SCOPe Domain Sequences for d2vgpb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vgpb_ d.144.1.7 (B:) automated matches {African clawed frog (Xenopus laevis) [TaxId: 8355]}
talaempkrkftiddfdigrplgkgkfgnvylarekqnkfimalkvlfksqlekegvehq
lrreieiqshlrhpnilrmynyfhdrkriylmlefaprgelykelqkhgrfdeqrsatfm
eeladalhycherkvihrdikpenllmgykgelkiadfgwsvhapslrrrtmcgtldylp
pemiegkthdekvdlwcagvlcyeflvgmppfdspshtethrrivnvdlkfppflsdgsk
dliskllryhppqrlplkgvmehpwvkansrrvlppvy

SCOPe Domain Coordinates for d2vgpb_:

Click to download the PDB-style file with coordinates for d2vgpb_.
(The format of our PDB-style files is described here.)

Timeline for d2vgpb_: