Lineage for d1hij__ (1hij -)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) 
Fold a.26: 4-helical cytokines [47265] (1 superfamily) Superfamily a.26.1: 4-helical cytokines [47266] (3 families) 
Family a.26.1.2: Short-chain cytokines [47286] (9 proteins) 
Protein Interleukin-4 (IL-4) [47291] (1 species) Species Human (Homo sapiens) [TaxId:9606] [47292] (12 PDB entries) 
Domain d1hij__: 1hij - [16857]
Details for d1hij__
PDB Entry: 1hij (more details), 3 Å
PDB Description: interleukin-4 mutant with arg 88 replaced with gln (r88q)
SCOP Domain Sequences for d1hij__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hij__ a.26.1.2 (-) Interleukin-4 (IL-4) {Human (Homo sapiens)}
hkcditlqeiiktlnslteqktlcteltvtdifaaskntteketfcraatvlrqfyshhe
kdtrclgataqqfhrhkqlirflkrldqnlwglaglnscpvkeanqstlenflerlktim
rekyskcss
SCOP Domain Coordinates for d1hij__:
Click to download the PDB-style file with coordinates for d1hij__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1hij__:
- d1hij__ appears in SCOP 1.57
- d1hij__ appears in the current release, SCOPe 2.08, called d1hija_
View in 3D