| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.49: Pyruvate kinase C-terminal domain-like [52934] (2 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145, strand 5 is antiparallel to the rest |
Superfamily c.49.1: PK C-terminal domain-like [52935] (2 families) ![]() |
| Family c.49.1.1: Pyruvate kinase, C-terminal domain [52936] (1 protein) automatically mapped to Pfam PF02887 |
| Protein Pyruvate kinase, C-terminal domain [52937] (6 species) |
| Species Human (Homo sapiens) [TaxId:9606] [82431] (8 PDB entries) |
| Domain d2vgfb3: 2vgf B:440-573 [168557] Other proteins in same PDB: d2vgfa1, d2vgfa2, d2vgfb1, d2vgfb2, d2vgfc1, d2vgfc2, d2vgfd1, d2vgfd2 complexed with fbp, k, mn, pga; mutant |
PDB Entry: 2vgf (more details), 2.75 Å
SCOPe Domain Sequences for d2vgfb3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vgfb3 c.49.1.1 (B:440-573) Pyruvate kinase, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
elrraaplsrdptevtaigaveaafkccaaaiivltttgrsaqllsryrpraaviavtrs
aqaarqvhlcrgvfpllyreppeaiwaddvdrrvqfgiesgklrgflrvgdlvivvtgwr
pgsgytnimrvlsi
Timeline for d2vgfb3: