Lineage for d2vgfa3 (2vgf A:440-573)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2880867Fold c.49: Pyruvate kinase C-terminal domain-like [52934] (2 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145, strand 5 is antiparallel to the rest
  4. 2880868Superfamily c.49.1: PK C-terminal domain-like [52935] (2 families) (S)
  5. 2880869Family c.49.1.1: Pyruvate kinase, C-terminal domain [52936] (1 protein)
    automatically mapped to Pfam PF02887
  6. 2880870Protein Pyruvate kinase, C-terminal domain [52937] (6 species)
  7. 2880891Species Human (Homo sapiens) [TaxId:9606] [82431] (8 PDB entries)
  8. 2880904Domain d2vgfa3: 2vgf A:440-573 [168554]
    Other proteins in same PDB: d2vgfa1, d2vgfa2, d2vgfb1, d2vgfb2, d2vgfc1, d2vgfc2, d2vgfd1, d2vgfd2
    complexed with fbp, k, mn, pga; mutant

Details for d2vgfa3

PDB Entry: 2vgf (more details), 2.75 Å

PDB Description: human erythrocyte pyruvate kinase: t384m mutant
PDB Compounds: (A:) pyruvate kinase isozymes r/l

SCOPe Domain Sequences for d2vgfa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vgfa3 c.49.1.1 (A:440-573) Pyruvate kinase, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
elrraaplsrdptevtaigaveaafkccaaaiivltttgrsaqllsryrpraaviavtrs
aqaarqvhlcrgvfpllyreppeaiwaddvdrrvqfgiesgklrgflrvgdlvivvtgwr
pgsgytnimrvlsi

SCOPe Domain Coordinates for d2vgfa3:

Click to download the PDB-style file with coordinates for d2vgfa3.
(The format of our PDB-style files is described here.)

Timeline for d2vgfa3: