Lineage for d2vgbc1 (2vgb C:160-261)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1799609Fold b.58: PK beta-barrel domain-like [50799] (1 superfamily)
    barrel, closed; n=7, S=10; complex topology
  4. 1799610Superfamily b.58.1: PK beta-barrel domain-like [50800] (2 families) (S)
  5. 1799611Family b.58.1.1: Pyruvate kinase beta-barrel domain [50801] (1 protein)
    this domain interrupts beta/alpha-barrel domain
    C-terminal domain is alpha/beta
  6. 1799612Protein Pyruvate kinase (PK) [50802] (6 species)
  7. 1799633Species Human (Homo sapiens) [TaxId:9606] [82151] (4 PDB entries)
  8. 1799636Domain d2vgbc1: 2vgb C:160-261 [168546]
    Other proteins in same PDB: d2vgba2, d2vgba3, d2vgbb2, d2vgbb3, d2vgbc2, d2vgbc3, d2vgbd2, d2vgbd3
    complexed with fbp, k, mn, pga

Details for d2vgbc1

PDB Entry: 2vgb (more details), 2.73 Å

PDB Description: human erythrocyte pyruvate kinase
PDB Compounds: (C:) pyruvate kinase isozymes r/l

SCOPe Domain Sequences for d2vgbc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vgbc1 b.58.1.1 (C:160-261) Pyruvate kinase (PK) {Human (Homo sapiens) [TaxId: 9606]}
peirtgilqggpesevelvkgsqvlvtvdpafrtrgnantvwvdypnivrvvpvggriyi
ddglislvvqkigpeglvtqvenggvlgsrkgvnlpgaqvdl

SCOPe Domain Coordinates for d2vgbc1:

Click to download the PDB-style file with coordinates for d2vgbc1.
(The format of our PDB-style files is described here.)

Timeline for d2vgbc1: