Class b: All beta proteins [48724] (180 folds) |
Fold b.58: PK beta-barrel domain-like [50799] (1 superfamily) barrel, closed; n=7, S=10; complex topology |
Superfamily b.58.1: PK beta-barrel domain-like [50800] (2 families) |
Family b.58.1.1: Pyruvate kinase beta-barrel domain [50801] (1 protein) this domain interrupts beta/alpha-barrel domain C-terminal domain is alpha/beta |
Protein Pyruvate kinase (PK) [50802] (6 species) |
Species Human (Homo sapiens) [TaxId:9606] [82151] (8 PDB entries) |
Domain d2vgbc1: 2vgb C:160-261 [168546] Other proteins in same PDB: d2vgba2, d2vgba3, d2vgbb2, d2vgbb3, d2vgbc2, d2vgbc3, d2vgbd2, d2vgbd3 complexed with fbp, k, mn, pga |
PDB Entry: 2vgb (more details), 2.73 Å
SCOPe Domain Sequences for d2vgbc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vgbc1 b.58.1.1 (C:160-261) Pyruvate kinase (PK) {Human (Homo sapiens) [TaxId: 9606]} peirtgilqggpesevelvkgsqvlvtvdpafrtrgnantvwvdypnivrvvpvggriyi ddglislvvqkigpeglvtqvenggvlgsrkgvnlpgaqvdl
Timeline for d2vgbc1: