Lineage for d2vgbb2 (2vgb B:57-159,B:262-439)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2088020Superfamily c.1.12: Phosphoenolpyruvate/pyruvate domain [51621] (8 families) (S)
  5. 2088021Family c.1.12.1: Pyruvate kinase [51622] (1 protein)
  6. 2088022Protein Pyruvate kinase, N-terminal domain [51623] (6 species)
    this domain is interrupted by an all-beta domain
    C-terminal domain is alpha/beta
  7. 2088043Species Human (Homo sapiens) [TaxId:9606] [82273] (8 PDB entries)
  8. 2088045Domain d2vgbb2: 2vgb B:57-159,B:262-439 [168544]
    Other proteins in same PDB: d2vgba1, d2vgba3, d2vgbb1, d2vgbb3, d2vgbc1, d2vgbc3, d2vgbd1, d2vgbd3
    complexed with fbp, k, mn, pga

Details for d2vgbb2

PDB Entry: 2vgb (more details), 2.73 Å

PDB Description: human erythrocyte pyruvate kinase
PDB Compounds: (B:) pyruvate kinase isozymes r/l

SCOPe Domain Sequences for d2vgbb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vgbb2 c.1.12.1 (B:57-159,B:262-439) Pyruvate kinase, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
qqqqlpaamadtflehlclldidsepvaarstsiiatigpasrsverlkemikagmniar
lnfshgsheyhaesianvreavesfagsplsyrpvaialdtkgXpglseqdvrdlrfgve
hgvdivfasfvrkasdvaavraalgpeghgikiiskienhegvkrfdeilevsdgimvar
gdlgieipaekvflaqkmmigrcnlagkpvvcatqmlesmitkprptraetsdvanavld
gadcimlsgetakgnfpveavkmqhaiareaeaavyhrqlfe

SCOPe Domain Coordinates for d2vgbb2:

Click to download the PDB-style file with coordinates for d2vgbb2.
(The format of our PDB-style files is described here.)

Timeline for d2vgbb2: