Lineage for d2vgba1 (2vgb A:160-261)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2413578Fold b.58: PK beta-barrel domain-like [50799] (1 superfamily)
    barrel, closed; n=7, S=10; complex topology
  4. 2413579Superfamily b.58.1: PK beta-barrel domain-like [50800] (2 families) (S)
  5. 2413580Family b.58.1.1: Pyruvate kinase beta-barrel domain [50801] (1 protein)
    this domain interrupts beta/alpha-barrel domain
    C-terminal domain is alpha/beta
  6. 2413581Protein Pyruvate kinase (PK) [50802] (6 species)
  7. 2413602Species Human (Homo sapiens) [TaxId:9606] [82151] (8 PDB entries)
  8. 2413603Domain d2vgba1: 2vgb A:160-261 [168540]
    Other proteins in same PDB: d2vgba2, d2vgba3, d2vgbb2, d2vgbb3, d2vgbc2, d2vgbc3, d2vgbd2, d2vgbd3
    complexed with fbp, k, mn, pga

Details for d2vgba1

PDB Entry: 2vgb (more details), 2.73 Å

PDB Description: human erythrocyte pyruvate kinase
PDB Compounds: (A:) pyruvate kinase isozymes r/l

SCOPe Domain Sequences for d2vgba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vgba1 b.58.1.1 (A:160-261) Pyruvate kinase (PK) {Human (Homo sapiens) [TaxId: 9606]}
peirtgilqggpesevelvkgsqvlvtvdpafrtrgnantvwvdypnivrvvpvggriyi
ddglislvvqkigpeglvtqvenggvlgsrkgvnlpgaqvdl

SCOPe Domain Coordinates for d2vgba1:

Click to download the PDB-style file with coordinates for d2vgba1.
(The format of our PDB-style files is described here.)

Timeline for d2vgba1: