Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.101: Undecaprenyl diphosphate synthase [64004] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 342156 |
Superfamily c.101.1: Undecaprenyl diphosphate synthase [64005] (2 families) the sheet topology is similar to those of the N-terminal domain of phosphoglycerate kinase and carbamate kinase |
Family c.101.1.0: automated matches [191361] (1 protein) not a true family |
Protein automated matches [190431] (4 species) not a true protein |
Species Mycobacterium tuberculosis [TaxId:1773] [188255] (3 PDB entries) |
Domain d2vg1a_: 2vg1 A: [168538] automated match to d1f75a_ complexed with fpp, gol, po4 |
PDB Entry: 2vg1 (more details), 1.7 Å
SCOPe Domain Sequences for d2vg1a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vg1a_ c.101.1.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]} sdlprhiavlcdgnrrwarsagyddvsygyrmgaakiaemlrwcheagielatvyllste nlqrdpdelaalieiitdvveeicapanhwsvrtvgdlgligeeparrlrgavestpeva sfhvnvavgyggrreivdavrallskelangataeelvdavtvegisenlytsgqpdpdl virtsgeqrlsgfllwqsaysemwfteahwpafrhvdflralrdysar
Timeline for d2vg1a_: