| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.101: Undecaprenyl diphosphate synthase [64004] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 342156 |
Superfamily c.101.1: Undecaprenyl diphosphate synthase [64005] (2 families) ![]() the sheet topology is similar to those of the N-terminal domain of phosphoglycerate kinase and carbamate kinase |
| Family c.101.1.0: automated matches [191361] (1 protein) not a true family |
| Protein automated matches [190431] (13 species) not a true protein |
| Species Mycobacterium tuberculosis [TaxId:1773] [188255] (3 PDB entries) |
| Domain d2vfwb_: 2vfw B: [168523] automated match to d1f75a_ complexed with so4 |
PDB Entry: 2vfw (more details), 2.3 Å
SCOPe Domain Sequences for d2vfwb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vfwb_ c.101.1.0 (B:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
dlprhiavlcdgnrrwarsagyddvsygyrmgaakiaemlrwcheagielatvyllsten
lqrdpdelaalieiitdvveeicapanhwsvrtvgdlgligeeparrlrgavestpevas
fhvnvavgyggrreivdavrallskelangataeelvdavtvegisenlytsgqpdpdlv
irtsgeqrlsgfllwqsaysemwfteahwpafrhvdflralrdysar
Timeline for d2vfwb_: