Lineage for d2vfib_ (2vfi B:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2089714Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2089715Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (2 families) (S)
  5. 2089716Family c.1.1.1: Triosephosphate isomerase (TIM) [51352] (2 proteins)
    automatically mapped to Pfam PF00121
  6. 2089717Protein Triosephosphate isomerase [51353] (20 species)
  7. 2089798Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [51359] (31 PDB entries)
    Uniprot Q07412
  8. 2089844Domain d2vfib_: 2vfi B: [168516]
    automated match to d1lyxa_
    complexed with 3pg

Details for d2vfib_

PDB Entry: 2vfi (more details), 2.25 Å

PDB Description: crystal structure of the plasmodium falciparum triosephosphate isomerase in the loop closed state with 3-phosphoglycerate bound at the active site and interface
PDB Compounds: (B:) triosephosphate isomerase

SCOPe Domain Sequences for d2vfib_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vfib_ c.1.1.1 (B:) Triosephosphate isomerase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
rkyfvaanwkcngtlesiksltnsfnnldfdpskldvvvfpvsvhydhtrkllqskfstg
iqnvskfgngsytgevsaeiakdlnieyviighferrkyfhetdedvreklqaslknnlk
avvcfgesleqreqnktievitkqvkafvdlidnfdnvilvyeplwaigtgktatpeqaq
lvhkeirkivkdtcgekqanqirilyggsvntencssliqqedidgflvgnaslkesfvd
iiksam

SCOPe Domain Coordinates for d2vfib_:

Click to download the PDB-style file with coordinates for d2vfib_.
(The format of our PDB-style files is described here.)

Timeline for d2vfib_: