Lineage for d2vfhb_ (2vfh B:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1815292Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1815293Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (2 families) (S)
  5. 1815294Family c.1.1.1: Triosephosphate isomerase (TIM) [51352] (2 proteins)
    automatically mapped to Pfam PF00121
  6. 1815295Protein Triosephosphate isomerase [51353] (20 species)
  7. 1815372Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [51359] (25 PDB entries)
    Uniprot Q07412
  8. 1815398Domain d2vfhb_: 2vfh B: [168514]
    automated match to d1lyxa_
    complexed with 3pg; mutant

Details for d2vfhb_

PDB Entry: 2vfh (more details), 2 Å

PDB Description: crystal structure of the f96w mutant of plasmodium falciparum triosephosphate isomerase complexed with 3-phosphoglycerate
PDB Compounds: (B:) triosephosphate isomerase

SCOPe Domain Sequences for d2vfhb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vfhb_ c.1.1.1 (B:) Triosephosphate isomerase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
arkyfvaanwkcngtlesiksltnsfnnldfdpskldvvvfpvsvhydhtrkllqskfst
giqnvskfgngsytgevsaeiakdlnieyviighwerrkyfhetdedvreklqaslknnl
kavvcfgesleqreqnktievitkqvkafvdlidnfdnvilvyeplwaigtgktatpeqa
qlvhkeirkivkdtcgekqanqirilyggsvntencssliqqedidgflvgnaslkesfv
diiksam

SCOPe Domain Coordinates for d2vfhb_:

Click to download the PDB-style file with coordinates for d2vfhb_.
(The format of our PDB-style files is described here.)

Timeline for d2vfhb_: