Lineage for d2vfha_ (2vfh A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2826026Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (2 families) (S)
  5. 2826027Family c.1.1.1: Triosephosphate isomerase (TIM) [51352] (2 proteins)
    automatically mapped to Pfam PF00121
  6. 2826028Protein Triosephosphate isomerase [51353] (21 species)
  7. 2826142Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [51359] (31 PDB entries)
    Uniprot Q07412
  8. 2826167Domain d2vfha_: 2vfh A: [168513]
    automated match to d1lyxa_
    complexed with 3pg; mutant

Details for d2vfha_

PDB Entry: 2vfh (more details), 2 Å

PDB Description: crystal structure of the f96w mutant of plasmodium falciparum triosephosphate isomerase complexed with 3-phosphoglycerate
PDB Compounds: (A:) triosephosphate isomerase

SCOPe Domain Sequences for d2vfha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vfha_ c.1.1.1 (A:) Triosephosphate isomerase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
arkyfvaanwkcngtlesiksltnsfnnldfdpskldvvvfpvsvhydhtrkllqskfst
giqnvskfgngsytgevsaeiakdlnieyviighwerrkyfhetdedvreklqaslknnl
kavvcfgesleqreqnktievitkqvkafvdlidnfdnvilvyeplwaigtgktatpeqa
qlvhkeirkivkdtcgekqanqirilyggsvntencssliqqedidgflvgnaslkesfv
diiksam

SCOPe Domain Coordinates for d2vfha_:

Click to download the PDB-style file with coordinates for d2vfha_.
(The format of our PDB-style files is described here.)

Timeline for d2vfha_: