SCOPe 2.07: Domain d1csga1: 1csg A:5-110

Lineage for d1csga1 (1csg A:5-110)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.26: 4-helical cytokines [47265] (1 superfamily)
   core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections

4. Superfamily a.26.1: 4-helical cytokines [47266] (4 families)
   there are two different topoisomers of this fold with different entanglements of the two crossover connections

5. Family a.26.1.2: Short-chain cytokines [47286] (14 proteins)

6. Protein Granulocyte-macrophage colony-stimulating factor (GM-CSF) [47289] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47290] (8 PDB entries)

8. Domain d1csga1: 1csg A:5-110 [16851]
   Other proteins in same PDB: d1csga2, d1csgb2

Details for d1csga1

PDB Entry: 1csg, 2.7 Å

PDB Description: three-dimensional structure of recombinant human granulocyte- macrophage colony-stimulating factor

PDB Compounds: (A:) granulocyte-macrophage colony-stimulating factor

SCOPe Domain Sequences for d1csga1:

Sequence; same for both SEQRES and ATOM records:

>d1csga1 a.26.1.2 (A:5-110) Granulocyte-macrophage colony-stimulating factor (GM-CSF) {Human (Homo sapiens) [TaxId: 9606]}
spspstqpwehvnaiqearrllnlsrdtaaemnetvevisemfdlqeptclqtrlelykq
glrgsltklkgpltmmashykqhcpptpetscatqiitfesfkenl

Timeline for d1csga1:

• d1csga1 first appeared (with stable ids) in SCOP 1.55, called d1csga_
  
• d1csga1 appears in SCOPe 2.06
  
• d1csga1 appears in the current release, SCOPe 2.08