Lineage for d1csga1 (1csg A:5-110)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1992769Fold a.26: 4-helical cytokines [47265] (1 superfamily)
    core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections
  4. 1992770Superfamily a.26.1: 4-helical cytokines [47266] (4 families) (S)
    there are two different topoisomers of this fold with different entanglements of the two crossover connections
  5. 1992868Family a.26.1.2: Short-chain cytokines [47286] (14 proteins)
  6. 1992880Protein Granulocyte-macrophage colony-stimulating factor (GM-CSF) [47289] (1 species)
  7. 1992881Species Human (Homo sapiens) [TaxId:9606] [47290] (8 PDB entries)
  8. 1992886Domain d1csga1: 1csg A:5-110 [16851]
    Other proteins in same PDB: d1csga2, d1csgb2

Details for d1csga1

PDB Entry: 1csg (more details), 2.7 Å

PDB Description: three-dimensional structure of recombinant human granulocyte- macrophage colony-stimulating factor
PDB Compounds: (A:) granulocyte colony-stimulating factor receptor

SCOPe Domain Sequences for d1csga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1csga1 a.26.1.2 (A:5-110) Granulocyte-macrophage colony-stimulating factor (GM-CSF) {Human (Homo sapiens) [TaxId: 9606]}
spspstqpwehvnaiqearrllnlsrdtaaemnetvevisemfdlqeptclqtrlelykq
glrgsltklkgpltmmashykqhcpptpetscatqiitfesfkenl

SCOPe Domain Coordinates for d1csga1:

Click to download the PDB-style file with coordinates for d1csga1.
(The format of our PDB-style files is described here.)

Timeline for d1csga1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1csga2