SCOPe 2.04: Domain d2vfeb_: 2vfe B:

Lineage for d2vfeb_ (2vfe B:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (2 families)

5. Family c.1.1.1: Triosephosphate isomerase (TIM) [51352] (2 proteins)
   automatically mapped to Pfam PF00121

6. Protein Triosephosphate isomerase [51353] (20 species)

7. Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [51359] (20 PDB entries)
   Uniprot Q07412

8. Domain d2vfeb_: 2vfe B: [168506]
   automated match to d1lyxa_
   complexed with 3pg, gol; mutant

Details for d2vfeb_

PDB Entry: 2vfe, 2.2 Å

PDB Description: crystal structure of f96s mutant of plasmodium falciparum triosephosphate isomerase with 3-phosphoglycerate bound at the dimer interface

PDB Compounds: (B:) triosephosphate isomerase

SCOPe Domain Sequences for d2vfeb_:

Sequence; same for both SEQRES and ATOM records:

>d2vfeb_ c.1.1.1 (B:) Triosephosphate isomerase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
rkyfvaanwkcngtlesiksltnsfnnldfdpskldvvvfpvsvhydhtrkllqskfstg
iqnvskfgngsytgevsaeiakdlnieyviighserrkyfhetdedvreklqaslknnlk
avvcfgesleqreqnktievitkqvkafvdlidnfdnvilvyeplwaigtgktatpeqaq
lvhkeirkivkdtcgekqanqirilyggsvntencssliqqedidgflvgnaslkesfvd
iiksam

Timeline for d2vfeb_:

• d2vfeb_ first appeared in SCOPe 2.01
  
• d2vfeb_ appears in SCOPe 2.03
  
• d2vfeb_ appears in SCOPe 2.05
  
• d2vfeb_ appears in the current release, SCOPe 2.08