Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (2 families) |
Family c.1.1.1: Triosephosphate isomerase (TIM) [51352] (1 protein) |
Protein Triosephosphate isomerase [51353] (20 species) |
Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [51359] (20 PDB entries) Uniprot Q07412 |
Domain d2vfea_: 2vfe A: [168505] automated match to d1lyxa_ complexed with 3pg, gol; mutant |
PDB Entry: 2vfe (more details), 2.2 Å
SCOPe Domain Sequences for d2vfea_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vfea_ c.1.1.1 (A:) Triosephosphate isomerase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} arkyfvaanwkcngtlesiksltnsfnnldfdpskldvvvfpvsvhydhtrkllqskfst giqnvskfgngsytgevsaeiakdlnieyviighserrkyfhetdedvreklqaslknnl kavvcfgesleqreqnktievitkqvkafvdlidnfdnvilvyeplwaigtgktatpeqa qlvhkeirkivkdtcgekqanqirilyggsvntencssliqqedidgflvgnaslkesfv diiksam
Timeline for d2vfea_: