![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
![]() | Superfamily d.3.1: Cysteine proteinases [54001] (24 families) ![]() the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
![]() | Family d.3.1.5: Arylamine N-acetyltransferase [54047] (2 proteins) fold similar to that of the factor XIII catalytic domain automatically mapped to Pfam PF00797 |
![]() | Protein automated matches [190090] (5 species) not a true protein |
![]() | Species Mycobacterium marinum [TaxId:1781] [188307] (4 PDB entries) |
![]() | Domain d2vfcb_: 2vfc B: [168502] automated match to d1gx3a_ complexed with coa |
PDB Entry: 2vfc (more details), 2.7 Å
SCOPe Domain Sequences for d2vfcb_:
Sequence, based on SEQRES records: (download)
>d2vfcb_ d.3.1.5 (B:) automated matches {Mycobacterium marinum [TaxId: 1781]} dltgyldrinyrgatdptldvlrdlvsahtgaiafenldplmgvpvddlsaealadklvd rrrggycyehngligyvlaelgyrvrrlagrvvwlappdaptpaqthtvlavtfpgcqgp ylvdvgfggmtptaplrletgtvqqtalepyrlddrgdglvlqamvrdewqalyefstlt rpqvdlrvgswfvsthptshfvtglmaatvaddarwnlmgrnlaihrrggtekilledaa avvdtlgdrfginvadvgergrlearidkvcf
>d2vfcb_ d.3.1.5 (B:) automated matches {Mycobacterium marinum [TaxId: 1781]} dltgyldrinygatdptldvlrdlvsahtgaiafenldplmgvpvddlsaealadklvdr rrggycyehngligyvlaelgyrvrrlagrvvwlappdaptpaqthtvlavtfpgcqgpy lvdvgfggmtptaplrletgtvqqtalepyrlddrgdglvlqamvrdewqalyefstltr pqvdlrvgswfvsthptshfvtglmaatvaddarwnlmgrnlaihrrggtekilledaaa vvdtlgdrfginvadvgergrlearidkvcf
Timeline for d2vfcb_: