Lineage for d2vfcb_ (2vfc B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2926589Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 2926590Superfamily d.3.1: Cysteine proteinases [54001] (24 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 2927182Family d.3.1.5: Arylamine N-acetyltransferase [54047] (2 proteins)
    fold similar to that of the factor XIII catalytic domain
    automatically mapped to Pfam PF00797
  6. 2927207Protein automated matches [190090] (5 species)
    not a true protein
  7. 2927213Species Mycobacterium marinum [TaxId:1781] [188307] (4 PDB entries)
  8. 2927218Domain d2vfcb_: 2vfc B: [168502]
    automated match to d1gx3a_
    complexed with coa

Details for d2vfcb_

PDB Entry: 2vfc (more details), 2.7 Å

PDB Description: the structure of mycobacterium marinum arylamine n-acetyltransferase in complex with coa
PDB Compounds: (B:) arylamine n-acetyltransferase

SCOPe Domain Sequences for d2vfcb_:

Sequence, based on SEQRES records: (download)

>d2vfcb_ d.3.1.5 (B:) automated matches {Mycobacterium marinum [TaxId: 1781]}
dltgyldrinyrgatdptldvlrdlvsahtgaiafenldplmgvpvddlsaealadklvd
rrrggycyehngligyvlaelgyrvrrlagrvvwlappdaptpaqthtvlavtfpgcqgp
ylvdvgfggmtptaplrletgtvqqtalepyrlddrgdglvlqamvrdewqalyefstlt
rpqvdlrvgswfvsthptshfvtglmaatvaddarwnlmgrnlaihrrggtekilledaa
avvdtlgdrfginvadvgergrlearidkvcf

Sequence, based on observed residues (ATOM records): (download)

>d2vfcb_ d.3.1.5 (B:) automated matches {Mycobacterium marinum [TaxId: 1781]}
dltgyldrinygatdptldvlrdlvsahtgaiafenldplmgvpvddlsaealadklvdr
rrggycyehngligyvlaelgyrvrrlagrvvwlappdaptpaqthtvlavtfpgcqgpy
lvdvgfggmtptaplrletgtvqqtalepyrlddrgdglvlqamvrdewqalyefstltr
pqvdlrvgswfvsthptshfvtglmaatvaddarwnlmgrnlaihrrggtekilledaaa
vvdtlgdrfginvadvgergrlearidkvcf

SCOPe Domain Coordinates for d2vfcb_:

Click to download the PDB-style file with coordinates for d2vfcb_.
(The format of our PDB-style files is described here.)

Timeline for d2vfcb_: