Lineage for d2vfca_ (2vfc A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2533756Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 2533757Superfamily d.3.1: Cysteine proteinases [54001] (24 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 2534351Family d.3.1.5: Arylamine N-acetyltransferase [54047] (2 proteins)
    fold similar to that of the factor XIII catalytic domain
    automatically mapped to Pfam PF00797
  6. 2534376Protein automated matches [190090] (5 species)
    not a true protein
  7. 2534382Species Mycobacterium marinum [TaxId:1781] [188307] (4 PDB entries)
  8. 2534385Domain d2vfca_: 2vfc A: [168501]
    automated match to d1gx3a_
    complexed with coa

Details for d2vfca_

PDB Entry: 2vfc (more details), 2.7 Å

PDB Description: the structure of mycobacterium marinum arylamine n-acetyltransferase in complex with coa
PDB Compounds: (A:) arylamine n-acetyltransferase

SCOPe Domain Sequences for d2vfca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vfca_ d.3.1.5 (A:) automated matches {Mycobacterium marinum [TaxId: 1781]}
dltgyldrinyrgatdptldvlrdlvsahtgaiafenldplmgvpvddlsaealadklvd
rrrggycyehngligyvlaelgyrvrrlagrvvwlappdaptpaqthtvlavtfpgcqgp
ylvdvgfggmtptaplrletgtvqqtalepyrlddrgdglvlqamvrdewqalyefstlt
rpqvdlrvgswfvsthptshfvtglmaatvaddarwnlmgrnlaihrrggtekilledaa
avvdtlgdrfginvadvgergrlearidkvcf

SCOPe Domain Coordinates for d2vfca_:

Click to download the PDB-style file with coordinates for d2vfca_.
(The format of our PDB-style files is described here.)

Timeline for d2vfca_: