Lineage for d2vfab_ (2vfa B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2128255Fold c.61: PRTase-like [53270] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 2128256Superfamily c.61.1: PRTase-like [53271] (3 families) (S)
  5. 2128257Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (16 protein domains)
  6. 2128615Protein automated matches [190074] (13 species)
    not a true protein
  7. 2128631Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [188472] (1 PDB entry)
  8. 2128633Domain d2vfab_: 2vfa B: [168499]
    automated match to d1bzya_
    complexed with 5gp, so4

Details for d2vfab_

PDB Entry: 2vfa (more details), 2.8 Å

PDB Description: crystal structure of a chimera of plasmodium falciparum and human hypoxanthine-guanine phosphoribosyl transferases
PDB Compounds: (B:) hypoxanthine-guanine-xanthine phosphoribosyltransferase, hypoxanthine-guanine phosphoribosyltransferase

SCOPe Domain Sequences for d2vfab_:

Sequence, based on SEQRES records: (download)

>d2vfab_ c.61.1.1 (B:) automated matches {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
afdpvfvkdddgydldsfmipahykkyltkvlvpngviknrieklardvmkemgghhiva
lcvlkggykffadlldyikalnrnsdrsipmtvdfirlksycndqstgdikviggddlst
ltgknvlivediidtgktmqtllslvrqynpkmvkvaclfikrtplwngfkadfvgfsip
dhfvvgysldyneifrdldhcclvndegkkkyka

Sequence, based on observed residues (ATOM records): (download)

>d2vfab_ c.61.1.1 (B:) automated matches {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
afdpvfvkdddgydldsfmipahykkyltkvlvpngviknrieklardvmkemgghhiva
lcvlkggykffadlldyikalnrnsdrsipmtvdfirlkdikviggddlstltgknvliv
ediidtgktmqtllslvrqynpkmvkvaclfikrtplwngfkadfvgfsipdhfvvgysl
dyneifrdldhcclvndegkkkyka

SCOPe Domain Coordinates for d2vfab_:

Click to download the PDB-style file with coordinates for d2vfab_.
(The format of our PDB-style files is described here.)

Timeline for d2vfab_: