Lineage for d2veta_ (2vet A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2578667Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily)
    contains large mixed beta-sheet
  4. 2578668Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (2 families) (S)
    automatically mapped to Pfam PF00303
  5. 2578669Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (4 proteins)
  6. 2578767Protein Thymidylate synthase [55833] (7 species)
  7. 2578782Species Escherichia coli [TaxId:562] [55834] (71 PDB entries)
  8. 2578895Domain d2veta_: 2vet A: [168497]
    automated match to d1aiqa_
    protein/RNA complex; complexed with fmt, ump

Details for d2veta_

PDB Entry: 2vet (more details), 2.2 Å

PDB Description: crystal structure of the thymidylate synthase k48q complexed with dump
PDB Compounds: (A:) Thymidylate synthase

SCOPe Domain Sequences for d2veta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2veta_ d.117.1.1 (A:) Thymidylate synthase {Escherichia coli [TaxId: 562]}
mkqylelmqkvldegtqkndrtgtgtlsifghqmrfnlqdgfplvttqrchlrsiihell
wflqgdtniaylhennvtiwdewadengdlgpvygkqwrawptpdgrhidqittvlnqlk
ndpdsrriivsawnvgeldkmalapchaffqfyvadgklscqlyqrscdvflglpfnias
yallvhmmaqqcdlevgdfvwtggdthlysnhmdqthlqlsreprplpkliikrkpesif
dyrfedfeiegydphpgikapvai

SCOPe Domain Coordinates for d2veta_:

Click to download the PDB-style file with coordinates for d2veta_.
(The format of our PDB-style files is described here.)

Timeline for d2veta_: