SCOPe 2.08: Domain d2velb_: 2vel B:

Lineage for d2velb_ (2vel B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (2 families)

5. Family c.1.1.1: Triosephosphate isomerase (TIM) [51352] (2 proteins)
   automatically mapped to Pfam PF00121

6. Protein Triosephosphate isomerase [51353] (21 species)

7. Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [51357] (41 PDB entries)

8. Domain d2velb_: 2vel B: [168492]
   automated match to d1dkwa_
   complexed with cl, pga; mutant

Details for d2velb_

PDB Entry: 2vel, 2.3 Å

PDB Description: structure-based enzyme engineering efforts with an inactive monomeric tim variant: the importance of a single point mutation for generating an active site with suitable binding properties

PDB Compounds: (B:) glycosomal triosephosphate isomerase

SCOPe Domain Sequences for d2velb_:

Sequence; same for both SEQRES and ATOM records:

>d2velb_ c.1.1.1 (B:) Triosephosphate isomerase {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
skpqpiaaanwksgspdslselidlfnstsinhdvqcvvastfvhlamtkerlshpkfvi
aaqnagnadalaslkdfgvnwivlghserrwyygetneivadkvaaavasgfmviacige
tlqeresgrtavvvltqiaaiakklkkadwakvviayepvwaigtgkvatpqqaqeahal
irswvsskigadvagelrilyggsvngknartlyqqrdvngflaglkpefvdiikatq

Timeline for d2velb_:

• d2velb_ first appeared in SCOPe 2.01
  
• d2velb_ appears in SCOPe 2.07