Lineage for d2vela_ (2vel A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2089714Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2089715Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (2 families) (S)
  5. 2089716Family c.1.1.1: Triosephosphate isomerase (TIM) [51352] (2 proteins)
    automatically mapped to Pfam PF00121
  6. 2089717Protein Triosephosphate isomerase [51353] (20 species)
  7. 2089953Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [51357] (41 PDB entries)
  8. 2090013Domain d2vela_: 2vel A: [168491]
    automated match to d1dkwa_
    complexed with cl, pga; mutant

Details for d2vela_

PDB Entry: 2vel (more details), 2.3 Å

PDB Description: structure-based enzyme engineering efforts with an inactive monomeric tim variant: the importance of a single point mutation for generating an active site with suitable binding properties
PDB Compounds: (A:) glycosomal triosephosphate isomerase

SCOPe Domain Sequences for d2vela_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vela_ c.1.1.1 (A:) Triosephosphate isomerase {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
skpqpiaaanwksgspdslselidlfnstsinhdvqcvvastfvhlamtkerlshpkfvi
aaqnagnadalaslkdfgvnwivlghserrwyygetneivadkvaaavasgfmviacige
tlqeresgrtavvvltqiaaiakklkkadwakvviayepvwaigtgkvatpqqaqeahal
irswvsskigadvagelrilyggsvngknartlyqqrdvngflaglkpefvdiikatq

SCOPe Domain Coordinates for d2vela_:

Click to download the PDB-style file with coordinates for d2vela_.
(The format of our PDB-style files is described here.)

Timeline for d2vela_: