![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.26: 4-helical cytokines [47265] (1 superfamily) core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections |
![]() | Superfamily a.26.1: 4-helical cytokines [47266] (4 families) ![]() there are two different topoisomers of this fold with different entanglements of the two crossover connections |
![]() | Family a.26.1.2: Short-chain cytokines [47286] (14 proteins) |
![]() | Protein Granulocyte-macrophage colony-stimulating factor (GM-CSF) [47289] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [47290] (10 PDB entries) |
![]() | Domain d2gmfa1: 2gmf A:4-110 [16849] Other proteins in same PDB: d2gmfa2, d2gmfb2 |
PDB Entry: 2gmf (more details), 2.4 Å
SCOPe Domain Sequences for d2gmfa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gmfa1 a.26.1.2 (A:4-110) Granulocyte-macrophage colony-stimulating factor (GM-CSF) {Human (Homo sapiens) [TaxId: 9606]} rspspstqpwehvnaiqearrllnlsrdtaaemnetvevisemfdlqeptclqtrlelyk qglrgsltklkgpltmmashykqhcpptpetscatqiitfesfkenl
Timeline for d2gmfa1: