Lineage for d2veib_ (2vei B:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1143364Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1143365Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (2 families) (S)
  5. 1143366Family c.1.1.1: Triosephosphate isomerase (TIM) [51352] (2 proteins)
  6. 1143367Protein Triosephosphate isomerase [51353] (21 species)
  7. 1143565Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [51357] (41 PDB entries)
  8. 1143582Domain d2veib_: 2vei B: [168487]
    automated match to d1dkwa_
    complexed with so4; mutant

Details for d2veib_

PDB Entry: 2vei (more details), 1.89 Å

PDB Description: structure-based enzyme engineering efforts with an inactive monomeric tim variant: the importance of a single point mutation for generating an active site with suitable binding properties
PDB Compounds: (B:) glycosomal triosephosphate isomerase

SCOPe Domain Sequences for d2veib_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2veib_ c.1.1.1 (B:) Triosephosphate isomerase {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
skpqpiaaanwksgspdslselidlfnstsinhdvqcvvastfvhlamtkerlshpkfvi
aaqnagnadalaslkdfgvnwivlghserrwyygetneivadkvaaavasgfmviacige
tlqeresgrtavvvltqiaaiakklkkadwakvviayepvwaigtgkvatpqqaqeahal
irswvsskigadvagelrilyggsvngknartlyqqrdvngflvglkpefvdiikatq

SCOPe Domain Coordinates for d2veib_:

Click to download the PDB-style file with coordinates for d2veib_.
(The format of our PDB-style files is described here.)

Timeline for d2veib_: