SCOPe 2.06: Domain d2ve1a_: 2ve1 A:

Lineage for d2ve1a_ (2ve1 A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families)
   Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold

5. Family b.82.2.1: Penicillin synthase-like [51198] (5 proteins)
   common fold is rather distorted

6. Protein automated matches [190217] (4 species)
   not a true protein

7. Species Emericella nidulans [TaxId:162425] [186976] (12 PDB entries)

8. Domain d2ve1a_: 2ve1 A: [168485]
   automated match to d1bk0a_
   complexed with fe2, m11, w2x

Details for d2ve1a_

PDB Entry: 2ve1, 2.2 Å

PDB Description: isopenicillin n synthase with substrate analogue asmcov (oxygen exposed 1min 20bar)

PDB Compounds: (A:) isopenicillin n synthetase

SCOPe Domain Sequences for d2ve1a_:

Sequence; same for both SEQRES and ATOM records:

>d2ve1a_ b.82.2.1 (A:) automated matches {Emericella nidulans [TaxId: 162425]}
svskanvpkidvsplfgddqaakmrvaqqidaasrdtgffyavnhginvqrlsqktkefh
msitpeekwdlairaynkehqdqvragyylsipgkkavesfcylnpnftpdhpriqaktp
thevnvwpdetkhpgfqdfaeqyywdvfglssallkgyalalgkeenffarhfkpddtla
svvlirypyldpypeaaiktaadgtklsfewhedvslitvlyqsnvqnlqvetaagyqdi
eaddtgylincgsymahltnnyykapihrvkwvnaerqslpffvnlgydsvidpfdprep
ngksdreplsygdylqnglvslinkngqt

Timeline for d2ve1a_:

• d2ve1a_ first appeared in SCOPe 2.01
  
• d2ve1a_ appears in SCOPe 2.05
  
• d2ve1a_ appears in SCOPe 2.07
  
• d2ve1a_ appears in the current release, SCOPe 2.08