Lineage for d2vdja_ (2vdj A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2101600Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2104318Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families) (S)
    conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures
  5. 2104720Family c.23.16.8: HTS-like [142077] (2 protein domains)
    Pfam PF04204
  6. 2104726Protein automated matches [190897] (1 species)
    not a true protein
  7. 2104727Species Bacillus cereus [TaxId:1396] [188326] (1 PDB entry)
  8. 2104728Domain d2vdja_: 2vdj A: [168480]
    automated match to d2ghra1
    complexed with hse, so4

Details for d2vdja_

PDB Entry: 2vdj (more details), 2 Å

PDB Description: crystal structure of homoserine o-acetyltransferase (meta) from bacillus cereus with homoserine
PDB Compounds: (A:) Homoserine O-succinyltransferase

SCOPe Domain Sequences for d2vdja_:

Sequence, based on SEQRES records: (download)

>d2vdja_ c.23.16.8 (A:) automated matches {Bacillus cereus [TaxId: 1396]}
eenifvmtkeraetqdiralkiailnlmptkqeteaqllrligntplqldvhllhmeshl
srnvaqehltsfyktfrdienekfdgliitgapvetlsfeevdyweelkrimeysktnvt
stlhicwgaqaglyhhygvqkyplkekmfgvfehevreqhvkllqgfdelffavhsrhte
vresdirevkeltllanseeagvhlvigqegrqvfalghseyscdtlkqeyerdrdkgln
idvpknyfkhdnpnekplvrwrshgnllfsnwlnyyvyqe

Sequence, based on observed residues (ATOM records): (download)

>d2vdja_ c.23.16.8 (A:) automated matches {Bacillus cereus [TaxId: 1396]}
eenifvmtkeraetqdiralkiailnlmptkqeteaqllrligntplqldvhllhmessf
yktfrdienekfdgliitgapvetlsfeevdyweelkrimeysktnvtstlhicwgaqag
lyhhygvqkyplkekmfgvfehevreqhvkllqgfdelffavhsrhtevresdirevkel
tllanseeagvhlvigqegrqvfalghseyscdtlkqeyerdrdkglnidvpknyfkhdn
pnekplvrwrshgnllfsnwlnyyvyqe

SCOPe Domain Coordinates for d2vdja_:

Click to download the PDB-style file with coordinates for d2vdja_.
(The format of our PDB-style files is described here.)

Timeline for d2vdja_: