Lineage for d2vdii_ (2vdi I:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2200260Fold d.73: RuBisCO, small subunit [55238] (1 superfamily)
    alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta
  4. 2200261Superfamily d.73.1: RuBisCO, small subunit [55239] (2 families) (S)
  5. 2200262Family d.73.1.1: RuBisCO, small subunit [55240] (2 proteins)
  6. 2200263Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [55241] (8 species)
  7. 2200282Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [69758] (6 PDB entries)
  8. 2200311Domain d2vdii_: 2vdi I: [168472]
    Other proteins in same PDB: d2vdia1, d2vdia2, d2vdib1, d2vdib2, d2vdic1, d2vdic2, d2vdid1, d2vdid2, d2vdie1, d2vdie2, d2vdif1, d2vdif2, d2vdig1, d2vdig2, d2vdih1, d2vdih2
    automated match to d2v63i1
    complexed with cap, edo, mg; mutant

Details for d2vdii_

PDB Entry: 2vdi (more details), 2.65 Å

PDB Description: crystal structure of chlamydomonas reinhardtii rubisco with a large- subunit c192s mutation
PDB Compounds: (I:) ribulose bisphosphate carboxylase small chain 1

SCOPe Domain Sequences for d2vdii_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vdii_ d.73.1.1 (I:) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]}
mmvwtpvnnkmfetfsylppltdeqiaaqvdyivangwipclefaeadkayvsnesairf
gsvsclyydnrywtmwklpmfgcrdpmqvlreivactkafpdayvrlvafdnqkqvqimg
flvqrpktardfqpankrsv

SCOPe Domain Coordinates for d2vdii_:

Click to download the PDB-style file with coordinates for d2vdii_.
(The format of our PDB-style files is described here.)

Timeline for d2vdii_: