SCOP 1.63: Domain d1cn4c_: 1cn4 C:

Lineage for d1cn4c_ (1cn4 C:)

1. Root: SCOP 1.63

2. Class a: All alpha proteins [46456] (171 folds)

3. Fold a.26: 4-helical cytokines [47265] (1 superfamily)
   core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections

4. Superfamily a.26.1: 4-helical cytokines [47266] (3 families)
   there are two different topoisomers of this fold with different entanglments of the two crossover connections

5. Family a.26.1.2: Short-chain cytokines [47286] (10 proteins)

6. Protein Erythropoietin [47287] (1 species)
   long chain cytokine with a short-chain cytokine topology

7. Species Human (Homo sapiens) [TaxId:9606] [47288] (3 PDB entries)

8. Domain d1cn4c_: 1cn4 C: [16847]
   Other proteins in same PDB: d1cn4a1, d1cn4a2, d1cn4b1, d1cn4b2
   mutant

Details for d1cn4c_

PDB Entry: 1cn4, 2.8 Å

PDB Description: erythropoietin complexed with extracellular domains of erythropoietin receptor

SCOP Domain Sequences for d1cn4c_:

Sequence, based on SEQRES records:

>d1cn4c_ a.26.1.2 (C:) Erythropoietin {Human (Homo sapiens)}
pprlicdsrvlerylleakeaekittgcaehcslnekitvpdtkvnfyawkrmevgqqav
evwqglallseavlrgqallvkssqpweplqlhvdkavsglrslttllralgaqkeaisp
pdaasaaplrtitadtfrklfrvysnflrgklklytgeacr

Sequence, based on observed residues (ATOM records):

>d1cn4c_ a.26.1.2 (C:) Erythropoietin {Human (Homo sapiens)}
pprlicdsrvlerylleakeaekittgcaehcslnekitvpdtkvnfyawkrmevgqqav
evwqglallseavlrgqallvkssqpweplqlhvdkavsglrslttllralgaqkeaisp
pdrtitadtfrklfrvysnflrgklklytgeacr

Timeline for d1cn4c_:

• d1cn4c_ first appeared (with stable ids) in SCOP 1.55
  
• d1cn4c_ appears in SCOP 1.61
  
• d1cn4c_ appears in SCOP 1.65
  
• d1cn4c_ appears in the current release, SCOPe 2.08