Lineage for d1cn4c_ (1cn4 C:)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 46942Fold a.26: 4-helical cytokines [47265] (1 superfamily)
  4. 46943Superfamily a.26.1: 4-helical cytokines [47266] (3 families) (S)
  5. 47004Family a.26.1.2: Short-chain cytokines [47286] (10 proteins)
  6. 47005Protein Erythropoietin [47287] (1 species)
  7. 47006Species Human (Homo sapiens) [TaxId:9606] [47288] (3 PDB entries)
  8. 47008Domain d1cn4c_: 1cn4 C: [16847]
    Other proteins in same PDB: d1cn4a1, d1cn4a2, d1cn4b1, d1cn4b2

Details for d1cn4c_

PDB Entry: 1cn4 (more details), 2.8 Å

PDB Description: erythropoietin complexed with extracellular domains of erythropoietin receptor

SCOP Domain Sequences for d1cn4c_:

Sequence, based on SEQRES records: (download)

>d1cn4c_ a.26.1.2 (C:) Erythropoietin {Human (Homo sapiens)}
pprlicdsrvlerylleakeaekittgcaehcslnekitvpdtkvnfyawkrmevgqqav
evwqglallseavlrgqallvkssqpweplqlhvdkavsglrslttllralgaqkeaisp
pdaasaaplrtitadtfrklfrvysnflrgklklytgeacr

Sequence, based on observed residues (ATOM records): (download)

>d1cn4c_ a.26.1.2 (C:) Erythropoietin {Human (Homo sapiens)}
pprlicdsrvlerylleakeaekittgcaehcslnekitvpdtkvnfyawkrmevgqqav
evwqglallseavlrgqallvkssqpweplqlhvdkavsglrslttllralgaqkeaisp
pdrtitadtfrklfrvysnflrgklklytgeacr

SCOP Domain Coordinates for d1cn4c_:

Click to download the PDB-style file with coordinates for d1cn4c_.
(The format of our PDB-style files is described here.)

Timeline for d1cn4c_: