![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.73: RuBisCO, small subunit [55238] (1 superfamily) alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta |
![]() | Superfamily d.73.1: RuBisCO, small subunit [55239] (2 families) ![]() |
![]() | Family d.73.1.1: RuBisCO, small subunit [55240] (2 proteins) |
![]() | Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [55241] (9 species) |
![]() | Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [69758] (6 PDB entries) |
![]() | Domain d2vdhj_: 2vdh J: [168465] Other proteins in same PDB: d2vdha1, d2vdha2, d2vdhb1, d2vdhb2, d2vdhc1, d2vdhc2, d2vdhd1, d2vdhd2, d2vdhe1, d2vdhe2, d2vdhf1, d2vdhf2, d2vdhg1, d2vdhg2, d2vdhh1, d2vdhh2 automated match to d2v63i1 complexed with cap, edo, mg; mutant |
PDB Entry: 2vdh (more details), 2.3 Å
SCOPe Domain Sequences for d2vdhj_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vdhj_ d.73.1.1 (J:) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]} mmvwtpvnnkmfetfsylppltdeqiaaqvdyivangwipclefaeadkayvsnesairf gsvsclyydnrywtmwklpmfgcrdpmqvlreivactkafpdayvrlvafdnqkqvqimg flvqrpktardfqpankrsv
Timeline for d2vdhj_: