| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.73: RuBisCO, small subunit [55238] (1 superfamily) alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta |
Superfamily d.73.1: RuBisCO, small subunit [55239] (1 family) ![]() |
| Family d.73.1.1: RuBisCO, small subunit [55240] (2 proteins) |
| Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [55241] (8 species) |
| Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [69758] (6 PDB entries) |
| Domain d2vdhi_: 2vdh I: [168464] automated match to d2v63i1 complexed with cap, edo, mg; mutant |
PDB Entry: 2vdh (more details), 2.3 Å
SCOPe Domain Sequences for d2vdhi_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vdhi_ d.73.1.1 (I:) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]}
mmvwtpvnnkmfetfsylppltdeqiaaqvdyivangwipclefaeadkayvsnesairf
gsvsclyydnrywtmwklpmfgcrdpmqvlreivactkafpdayvrlvafdnqkqvqimg
flvqrpktardfqpankrsv
Timeline for d2vdhi_: