Lineage for d2vcsa_ (2vcs A:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 919407Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 919408Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) (S)
  5. 919409Family a.93.1.1: CCP-like [48114] (5 proteins)
  6. 919665Protein automated matches [190089] (4 species)
    not a true protein
  7. 919696Species Soybean (Glycine max) [TaxId:3847] [187116] (14 PDB entries)
  8. 919704Domain d2vcsa_: 2vcs A: [168462]
    automated match to d1oafa_
    complexed with hem, isz, so4; mutant

Details for d2vcsa_

PDB Entry: 2vcs (more details), 1.68 Å

PDB Description: structure of isoniazid (inh) bound to cytosolic soybean ascorbate peroxidase mutant h42a
PDB Compounds: (A:) ascorbate peroxidase

SCOPe Domain Sequences for d2vcsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vcsa_ a.93.1.1 (A:) automated matches {Soybean (Glycine max) [TaxId: 3847]}
gksyptvsadyqkavekakkklrgfiaekrcaplmlrlawasagtfdkgtktggpfgtik
hpaelahsanngldiavrlleplkaefpilsyadfyqlagvvavevtggpevpfhpgred
kpepppegrlpdatkgsdhlrdvfgkamgltdqdivalsgghtigaahkersgfegpwts
nplifdnsyftellsgekegllqlpsdkallsdpvfrplvdkyaadedaffadyaeahqk
lselgfada

SCOPe Domain Coordinates for d2vcsa_:

Click to download the PDB-style file with coordinates for d2vcsa_.
(The format of our PDB-style files is described here.)

Timeline for d2vcsa_: