Lineage for d1evsa_ (1evs A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2705447Fold a.26: 4-helical cytokines [47265] (1 superfamily)
    core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections
  4. 2705448Superfamily a.26.1: 4-helical cytokines [47266] (4 families) (S)
    there are two different topoisomers of this fold with different entanglements of the two crossover connections
  5. 2705449Family a.26.1.1: Long-chain cytokines [47267] (10 proteins)
  6. 2705517Protein Oncostatin M [47284] (1 species)
  7. 2705518Species Human (Homo sapiens) [TaxId:9606] [47285] (1 PDB entry)
  8. 2705519Domain d1evsa_: 1evs A: [16845]

Details for d1evsa_

PDB Entry: 1evs (more details), 2.2 Å

PDB Description: crystal structure of human oncostatin m
PDB Compounds: (A:) oncostatin m

SCOPe Domain Sequences for d1evsa_:

Sequence, based on SEQRES records: (download)

>d1evsa_ a.26.1.1 (A:) Oncostatin M {Human (Homo sapiens) [TaxId: 9606]}
gscskeyrvllgqlqkqtdlmqdtsrlldpyiriqgldvpklrehcrerpgafpseetlr
glgrrgflqtlnatlgcvlhrladleqrlpkaqdlersglniedleklqmarpnilglrn
niycmaqlldnsdtaeptkagrgasqpptptpasdafqrklegcrflhgyhrfmhsvgrv
fskw

Sequence, based on observed residues (ATOM records): (download)

>d1evsa_ a.26.1.1 (A:) Oncostatin M {Human (Homo sapiens) [TaxId: 9606]}
gscskeyrvllgqlqkqtdlmqdtsrlldpyiriqgldvpklrehcrerpgafpseetlr
glgrrgflqtlnatlgcvlhrladleqrlpkaqdlersglniedleklqmarpnilglrn
niycmaqlldnasdafqrklegcrflhgyhrfmhsvgrvfskw

SCOPe Domain Coordinates for d1evsa_:

Click to download the PDB-style file with coordinates for d1evsa_.
(The format of our PDB-style files is described here.)

Timeline for d1evsa_: