SCOPe 2.08: Domain d1evsa_: 1evs A:

Lineage for d1evsa_ (1evs A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.26: 4-helical cytokines [47265] (1 superfamily)
   core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections

4. Superfamily a.26.1: 4-helical cytokines [47266] (4 families)
   there are two different topoisomers of this fold with different entanglements of the two crossover connections

5. Family a.26.1.1: Long-chain cytokines [47267] (10 proteins)

6. Protein Oncostatin M [47284] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47285] (1 PDB entry)

8. Domain d1evsa_: 1evs A: [16845]

Details for d1evsa_

PDB Entry: 1evs, 2.2 Å

PDB Description: crystal structure of human oncostatin m

PDB Compounds: (A:) oncostatin m

SCOPe Domain Sequences for d1evsa_:

Sequence, based on SEQRES records:

>d1evsa_ a.26.1.1 (A:) Oncostatin M {Human (Homo sapiens) [TaxId: 9606]}
gscskeyrvllgqlqkqtdlmqdtsrlldpyiriqgldvpklrehcrerpgafpseetlr
glgrrgflqtlnatlgcvlhrladleqrlpkaqdlersglniedleklqmarpnilglrn
niycmaqlldnsdtaeptkagrgasqpptptpasdafqrklegcrflhgyhrfmhsvgrv
fskw

Sequence, based on observed residues (ATOM records):

>d1evsa_ a.26.1.1 (A:) Oncostatin M {Human (Homo sapiens) [TaxId: 9606]}
gscskeyrvllgqlqkqtdlmqdtsrlldpyiriqgldvpklrehcrerpgafpseetlr
glgrrgflqtlnatlgcvlhrladleqrlpkaqdlersglniedleklqmarpnilglrn
niycmaqlldnasdafqrklegcrflhgyhrfmhsvgrvfskw

Timeline for d1evsa_:

• d1evsa_ first appeared (with stable ids) in SCOP 1.55
  
• d1evsa_ appears in SCOPe 2.07