| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.95: Homing endonuclease-like [55603] (2 superfamilies) alpha-beta(2)-alpha-beta(2)-alpha; 2 layers: a/b; antiparallel sheet 1243 |
Superfamily d.95.2: Homing endonucleases [55608] (3 families) ![]() |
| Family d.95.2.1: Group I mobile intron endonuclease [55609] (6 proteins) contains two extra helices in the C-terminal extension |
| Protein automated matches [190411] (4 species) not a true protein |
| Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [187286] (9 PDB entries) |
| Domain d2vbla_: 2vbl A: [168441] automated match to d1bp7a_ complexed with mg |
PDB Entry: 2vbl (more details), 1.8 Å
SCOPe Domain Sequences for d2vbla_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vbla_ d.95.2.1 (A:) automated matches {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]}
ntkynkefllylagfvdgdgsiiaqiepnasykfkhrlkltfkvtqktqrrwfldklvde
igvgyvrdegsvsnyilseikplrnfltqlqpflklkqkqanlvlkiteqlpsakespdk
flevctwvdqiaalndsktrkttsetvravld
Timeline for d2vbla_: