Lineage for d1ax8__ (1ax8 -)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 2641Fold a.26: 4-helical cytokines [47265] (1 superfamily)
  4. 2642Superfamily a.26.1: 4-helical cytokines [47266] (3 families) (S)
  5. 2643Family a.26.1.1: Long-chain cytokines [47267] (8 proteins)
  6. 2683Protein Leptin (obesity protein) [47282] (1 species)
  7. 2684Species Human (Homo sapiens) [TaxId:9606] [47283] (1 PDB entry)
  8. 2685Domain d1ax8__: 1ax8 - [16844]

Details for d1ax8__

PDB Entry: 1ax8 (more details), 2.4 Å

PDB Description: Human obesity protein, leptin

SCOP Domain Sequences for d1ax8__:

Sequence, based on SEQRES records: (download)

>d1ax8__ a.26.1.1 (-) Leptin (obesity protein) {Human (Homo sapiens)}
iqkvqddtktliktivtrindishtqsvsskqkvtgldfipglhpiltlskmdqtlavyq
qiltsmpsrnviqisndlenlrdllhvlafskschlpeasgletldslggvleasgyste
vvalsrlqgslqdmlwqldlspgc

Sequence, based on observed residues (ATOM records): (download)

>d1ax8__ a.26.1.1 (-) Leptin (obesity protein) {Human (Homo sapiens)}
iqkvqddtktliktivtrindildfipglhpiltlskmdqtlavyqqiltsmpsrnviqi
sndlenlrdllhvlafskschlpeasgletldslggvleasgystevvalsrlqgslqdm
lwqldlspgc

SCOP Domain Coordinates for d1ax8__:

Click to download the PDB-style file with coordinates for d1ax8__.
(The format of our PDB-style files is described here.)

Timeline for d1ax8__: