SCOPe 2.08: Domain d1ax8a_: 1ax8 A:

Lineage for d1ax8a_ (1ax8 A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.26: 4-helical cytokines [47265] (1 superfamily)
   core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections

4. Superfamily a.26.1: 4-helical cytokines [47266] (4 families)
   there are two different topoisomers of this fold with different entanglements of the two crossover connections

5. Family a.26.1.1: Long-chain cytokines [47267] (10 proteins)

6. Protein Leptin (obesity protein) [47282] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47283] (1 PDB entry)

8. Domain d1ax8a_: 1ax8 A: [16844]

Details for d1ax8a_

PDB Entry: 1ax8, 2.4 Å

PDB Description: Human obesity protein, leptin

PDB Compounds: (A:) obesity protein

SCOPe Domain Sequences for d1ax8a_:

Sequence, based on SEQRES records:

>d1ax8a_ a.26.1.1 (A:) Leptin (obesity protein) {Human (Homo sapiens) [TaxId: 9606]}
iqkvqddtktliktivtrindishtqsvsskqkvtgldfipglhpiltlskmdqtlavyq
qiltsmpsrnviqisndlenlrdllhvlafskschlpeasgletldslggvleasgyste
vvalsrlqgslqdmlwqldlspgc

Sequence, based on observed residues (ATOM records):

>d1ax8a_ a.26.1.1 (A:) Leptin (obesity protein) {Human (Homo sapiens) [TaxId: 9606]}
iqkvqddtktliktivtrindildfipglhpiltlskmdqtlavyqqiltsmpsrnviqi
sndlenlrdllhvlafskschlpeasgletldslggvleasgystevvalsrlqgslqdm
lwqldlspgc

Timeline for d1ax8a_:

• d1ax8a_ first appeared (with stable ids) in SCOP 1.55, called d1ax8__
  
• d1ax8a_ appears in SCOPe 2.07