Lineage for d2vaeh_ (2vae H:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1898883Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 1898884Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 1898885Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)
  6. 1899146Protein automated matches [190406] (16 species)
    not a true protein
  7. 1899215Species Coral (Discosoma sp.) [TaxId:86600] [188539] (17 PDB entries)
  8. 1899237Domain d2vaeh_: 2vae H: [168434]
    automated match to d1g7ka_
    complexed with edo

Details for d2vaeh_

PDB Entry: 2vae (more details), 1.64 Å

PDB Description: fast maturing red fluorescent protein, dsred.t4
PDB Compounds: (H:) red fluorescent protein

SCOPe Domain Sequences for d2vaeh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vaeh_ d.22.1.1 (H:) automated matches {Coral (Discosoma sp.) [TaxId: 86600]}
vikefmrfkvrmegsvnghefeiegegegrpyegtqtaklkvtkggplpfawdilspqfq
ygskvyvkhpadipdykklsfpegfkwervmnfedggvvtvtqdsslqdgcfiykvkfig
vnfpsdgpvmqkktmgwepsterlyprdgvlkgeihkalklkdgghylvefksiymakkp
vqlpgyyyvdsklditshnedytiveqyeraegrhhlfl

SCOPe Domain Coordinates for d2vaeh_:

Click to download the PDB-style file with coordinates for d2vaeh_.
(The format of our PDB-style files is described here.)

Timeline for d2vaeh_: