Lineage for d2vaef_ (2vae F:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2939772Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 2939773Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 2939774Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)
  6. 2940226Protein automated matches [190406] (19 species)
    not a true protein
  7. 2940296Species Coral (Discosoma sp.) [TaxId:86600] [188539] (22 PDB entries)
  8. 2940329Domain d2vaef_: 2vae F: [168432]
    automated match to d1g7ka_
    complexed with edo

Details for d2vaef_

PDB Entry: 2vae (more details), 1.64 Å

PDB Description: fast maturing red fluorescent protein, dsred.t4
PDB Compounds: (F:) red fluorescent protein

SCOPe Domain Sequences for d2vaef_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vaef_ d.22.1.1 (F:) automated matches {Coral (Discosoma sp.) [TaxId: 86600]}
vikefmrfkvrmegsvnghefeiegegegrpyegtqtaklkvtkggplpfawdilspqfq
ygskvyvkhpadipdykklsfpegfkwervmnfedggvvtvtqdsslqdgcfiykvkfig
vnfpsdgpvmqkktmgwepsterlyprdgvlkgeihkalklkdgghylvefksiymakkp
vqlpgyyyvdsklditshnedytiveqyeraegrhhlfl

SCOPe Domain Coordinates for d2vaef_:

Click to download the PDB-style file with coordinates for d2vaef_.
(The format of our PDB-style files is described here.)

Timeline for d2vaef_: