Lineage for d2vaed_ (2vae D:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2184480Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 2184481Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 2184482Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)
  6. 2184772Protein automated matches [190406] (19 species)
    not a true protein
  7. 2184845Species Coral (Discosoma sp.) [TaxId:86600] [188539] (21 PDB entries)
  8. 2184863Domain d2vaed_: 2vae D: [168430]
    automated match to d1g7ka_
    complexed with edo

Details for d2vaed_

PDB Entry: 2vae (more details), 1.64 Å

PDB Description: fast maturing red fluorescent protein, dsred.t4
PDB Compounds: (D:) red fluorescent protein

SCOPe Domain Sequences for d2vaed_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vaed_ d.22.1.1 (D:) automated matches {Coral (Discosoma sp.) [TaxId: 86600]}
vikefmrfkvrmegsvnghefeiegegegrpyegtqtaklkvtkggplpfawdilspqfq
ygskvyvkhpadipdykklsfpegfkwervmnfedggvvtvtqdsslqdgcfiykvkfig
vnfpsdgpvmqkktmgwepsterlyprdgvlkgeihkalklkdgghylvefksiymakkp
vqlpgyyyvdsklditshnedytiveqyeraegrhhlfl

SCOPe Domain Coordinates for d2vaed_:

Click to download the PDB-style file with coordinates for d2vaed_.
(The format of our PDB-style files is described here.)

Timeline for d2vaed_: