Lineage for d1cnt4_ (1cnt 4:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1992769Fold a.26: 4-helical cytokines [47265] (1 superfamily)
    core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections
  4. 1992770Superfamily a.26.1: 4-helical cytokines [47266] (4 families) (S)
    there are two different topoisomers of this fold with different entanglements of the two crossover connections
  5. 1992771Family a.26.1.1: Long-chain cytokines [47267] (10 proteins)
  6. 1992772Protein Ciliary neurotrophic factor (CNTF) [47280] (1 species)
  7. 1992773Species Human (Homo sapiens) [TaxId:9606] [47281] (1 PDB entry)
  8. 1992777Domain d1cnt4_: 1cnt 4: [16843]
    complexed with so4, yb

Details for d1cnt4_

PDB Entry: 1cnt (more details), 2.4 Å

PDB Description: ciliary neurotrophic factor
PDB Compounds: (4:) ciliary neurotrophic factor

SCOPe Domain Sequences for d1cnt4_:

Sequence, based on SEQRES records: (download)

>d1cnt4_ a.26.1.1 (4:) Ciliary neurotrophic factor (CNTF) {Human (Homo sapiens) [TaxId: 9606]}
hrrdlcsrsiwlarkirsdltaltesyvkhqglnkninldsadgmpvastdqwselteae
rlqenlqayrtfhvllarlledqqvhftptegdfhqaihtlllqvaafayqieelmille
ykiprneadgmpinvgdgglfekklwglkvlqelsqwtvrsihdlrfis

Sequence, based on observed residues (ATOM records): (download)

>d1cnt4_ a.26.1.1 (4:) Ciliary neurotrophic factor (CNTF) {Human (Homo sapiens) [TaxId: 9606]}
hrrdlcsrsiwlarkirsdltaltesyvkhqglelteaerlqenlqayrtfhvllarlle
dqqegdfhqaihtlllqvaafayqieelmilleykiprnkklwglkvlqelsqwtvrsih
dlrfis

SCOPe Domain Coordinates for d1cnt4_:

Click to download the PDB-style file with coordinates for d1cnt4_.
(The format of our PDB-style files is described here.)

Timeline for d1cnt4_: