Lineage for d1cnt4_ (1cnt 4:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 2641Fold a.26: 4-helical cytokines [47265] (1 superfamily)
  4. 2642Superfamily a.26.1: 4-helical cytokines [47266] (3 families) (S)
  5. 2643Family a.26.1.1: Long-chain cytokines [47267] (8 proteins)
  6. 2644Protein Ciliary neurotrophic factor (CNTF) [47280] (1 species)
  7. 2645Species Human (Homo sapiens) [TaxId:9606] [47281] (1 PDB entry)
  8. 2649Domain d1cnt4_: 1cnt 4: [16843]

Details for d1cnt4_

PDB Entry: 1cnt (more details), 2.4 Å

PDB Description: ciliary neurotrophic factor

SCOP Domain Sequences for d1cnt4_:

Sequence, based on SEQRES records: (download)

>d1cnt4_ a.26.1.1 (4:) Ciliary neurotrophic factor (CNTF) {Human (Homo sapiens)}
hrrdlcsrsiwlarkirsdltaltesyvkhqglnkninldsadgmpvastdqwselteae
rlqenlqayrtfhvllarlledqqvhftptegdfhqaihtlllqvaafayqieelmille
ykiprneadgmpinvgdgglfekklwglkvlqelsqwtvrsihdlrfis

Sequence, based on observed residues (ATOM records): (download)

>d1cnt4_ a.26.1.1 (4:) Ciliary neurotrophic factor (CNTF) {Human (Homo sapiens)}
hrrdlcsrsiwlarkirsdltaltesyvkhqglelteaerlqenlqayrtfhvllarlle
dqqegdfhqaihtlllqvaafayqieelmilleykiprnkklwglkvlqelsqwtvrsih
dlrfis

SCOP Domain Coordinates for d1cnt4_:

Click to download the PDB-style file with coordinates for d1cnt4_.
(The format of our PDB-style files is described here.)

Timeline for d1cnt4_: