![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.109: Gelsolin-like [55752] (3 superfamilies) 3 layers: a/b/a; contains mixed beta-sheet |
![]() | Superfamily d.109.1: Actin depolymerizing proteins [55753] (3 families) ![]() |
![]() | Family d.109.1.2: Cofilin-like [55762] (8 proteins) |
![]() | Protein automated matches [190045] (3 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [186766] (5 PDB entries) |
![]() | Domain d2vaca_: 2vac A: [168425] automated match to d1m4ja_ complexed with edo, zn |
PDB Entry: 2vac (more details), 1.7 Å
SCOPe Domain Sequences for d2vaca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vaca_ d.109.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} smgihateelkeffakaragsvrlikvviedeqlvlgasqepvgrwdqdydravlpllda qqpcyllyrldsqnaqgfewlflawspdnspvrlkmlyaatratvkkefggghikdelfg tvkddlsfagyqkh
Timeline for d2vaca_: