Class a: All alpha proteins [46456] (290 folds) |
Fold a.26: 4-helical cytokines [47265] (1 superfamily) core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections |
Superfamily a.26.1: 4-helical cytokines [47266] (4 families) there are two different topoisomers of this fold with different entanglements of the two crossover connections |
Family a.26.1.1: Long-chain cytokines [47267] (10 proteins) |
Protein Ciliary neurotrophic factor (CNTF) [47280] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [47281] (1 PDB entry) |
Domain d1cnt3_: 1cnt 3: [16842] complexed with so4, yb missing some secondary structures that made up less than one-third of the common domain |
PDB Entry: 1cnt (more details), 2.4 Å
SCOPe Domain Sequences for d1cnt3_:
Sequence, based on SEQRES records: (download)
>d1cnt3_ a.26.1.1 (3:) Ciliary neurotrophic factor (CNTF) {Human (Homo sapiens) [TaxId: 9606]} phrrdlcsrsiwlarkirsdltaltesyvkhqglnkninldsadgmpvastdqwseltea erlqenlqayrtfhvllarlledqqvhftptegdfhqaihtlllqvaafayqieelmill eykiprneadgmpinvgdgglfekklwglkvlqelsqwtvrsihdlrfissh
>d1cnt3_ a.26.1.1 (3:) Ciliary neurotrophic factor (CNTF) {Human (Homo sapiens) [TaxId: 9606]} phrrdlcsrsiwlarkirsdltaltesyvkhqglwselteaerlqenlqayrtfhvllar lledqqvhftptegdfhqaihtlllqvaafayqieelmilleykiprneadggglfekkl wglkvlqelsqwtvrsihdlrfissh
Timeline for d1cnt3_: