![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.85: beta-clip [51268] (7 superfamilies) double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll |
![]() | Superfamily b.85.4: dUTPase-like [51283] (2 families) ![]() forms tight trimer through an additional beta-sheet in each subunit subunit beta-sheets are orthogonally packed around the three-fold axis |
![]() | Family b.85.4.1: dUTPase-like [51284] (5 proteins) |
![]() | Protein Deoxycytidine triphosphate deaminase (dCTP deaminase) [117335] (2 species) |
![]() | Species Escherichia coli [TaxId:562] [117336] (6 PDB entries) Uniprot P28248 |
![]() | Domain d2v9xg_: 2v9x G: [168419] automated match to d1xs1a_ complexed with dut, mg, so4 has additional insertions and/or extensions that are not grouped together |
PDB Entry: 2v9x (more details), 2.2 Å
SCOPe Domain Sequences for d2v9xg_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2v9xg_ b.85.4.1 (G:) Deoxycytidine triphosphate deaminase (dCTP deaminase) {Escherichia coli [TaxId: 562]} mrlcdrdieawldegrlsinprppveringatvdvrlgnkfrtfrghtaafidlsgpkde vsaaldrvmsdeivldegeafylhpgelalavtlesvtlpadlvgwldgrsslarlglmv hvtahridpgwsgcivldfynsgklplalrpgmligalsfeplsgpavrpynrredakyr nqqgavasridkd
Timeline for d2v9xg_: