Class a: All alpha proteins [46456] (289 folds) |
Fold a.26: 4-helical cytokines [47265] (1 superfamily) core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections |
Superfamily a.26.1: 4-helical cytokines [47266] (4 families) there are two different topoisomers of this fold with different entanglements of the two crossover connections |
Family a.26.1.1: Long-chain cytokines [47267] (10 proteins) |
Protein Ciliary neurotrophic factor (CNTF) [47280] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [47281] (1 PDB entry) |
Domain d1cnt2_: 1cnt 2: [16841] complexed with so4, yb |
PDB Entry: 1cnt (more details), 2.4 Å
SCOPe Domain Sequences for d1cnt2_:
Sequence, based on SEQRES records: (download)
>d1cnt2_ a.26.1.1 (2:) Ciliary neurotrophic factor (CNTF) {Human (Homo sapiens) [TaxId: 9606]} hrrdlcsrsiwlarkirsdltaltesyvkhqglnkninldsadgmpvastdqwselteae rlqenlqayrtfhvllarlledqqvhftptegdfhqaihtlllqvaafayqieelmille ykiprneadgmpinvgdgglfekklwglkvlqelsqwtvrsihdlrfisshqtgip
>d1cnt2_ a.26.1.1 (2:) Ciliary neurotrophic factor (CNTF) {Human (Homo sapiens) [TaxId: 9606]} hrrdlcsrsiwlarkirsdltaltesyvkhqgllteaerlqenlqayrtfhvllarlleg dfhqaihtlllqvaafayqieelmilleykiprnfekklwglkvlqelsqwtvrsihdlr fisshqtgip
Timeline for d1cnt2_: