Lineage for d2v9oa_ (2v9o A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2155368Fold c.74: AraD/HMP-PK domain-like [53638] (1 superfamily)
    3 layers: a/b/a; mixed (mostly antiparallel) beta-sheet of 9 strands, order 432159876; left-handed crossover between strands 4 and 5
  4. 2155369Superfamily c.74.1: AraD/HMP-PK domain-like [53639] (3 families) (S)
  5. 2155370Family c.74.1.1: AraD-like aldolase/epimerase [53640] (5 proteins)
    metal (zinc)-ion dependent
  6. 2155445Protein automated matches [190894] (1 species)
    not a true protein
  7. 2155446Species Escherichia coli [TaxId:562] [188311] (7 PDB entries)
  8. 2155453Domain d2v9oa_: 2v9o A: [168406]
    automated match to d1gt7a_
    complexed with zn; mutant

Details for d2v9oa_

PDB Entry: 2v9o (more details), 1.95 Å

PDB Description: l-rhamnulose-1-phosphate aldolase from escherichia coli (mutant a87m- t109f-e192a)
PDB Compounds: (A:) rhamnulose-1-phosphate aldolase

SCOPe Domain Sequences for d2v9oa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2v9oa_ c.74.1.1 (A:) automated matches {Escherichia coli [TaxId: 562]}
mqnitqswfvqgmikattdawlkgwdernggnltlrlddadiapyhdnfhqqpryiplsq
pmpllantpfivtgsgkffrnvqldpmanlgivkvdsdgagyhilwglfneavptselpa
hflshcerikatngkdrvimhchatnlialtyvlendtavftrqlwegsteclvvfpdgv
gilpwmvpgtdaigqataqemqkhslvlwpfhgvfgsgptldetfglidtaeksaqvlvk
vysmggmkqtisreelialgkrfgvtplasalal

SCOPe Domain Coordinates for d2v9oa_:

Click to download the PDB-style file with coordinates for d2v9oa_.
(The format of our PDB-style files is described here.)

Timeline for d2v9oa_: