Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.74: AraD/HMP-PK domain-like [53638] (1 superfamily) 3 layers: a/b/a; mixed (mostly antiparallel) beta-sheet of 9 strands, order 432159876; left-handed crossover between strands 4 and 5 |
Superfamily c.74.1: AraD/HMP-PK domain-like [53639] (3 families) |
Family c.74.1.1: AraD-like aldolase/epimerase [53640] (5 proteins) metal (zinc)-ion dependent |
Protein automated matches [190894] (1 species) not a true protein |
Species Escherichia coli [TaxId:562] [188311] (7 PDB entries) |
Domain d2v9oa_: 2v9o A: [168406] automated match to d1gt7a_ complexed with zn; mutant |
PDB Entry: 2v9o (more details), 1.95 Å
SCOPe Domain Sequences for d2v9oa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2v9oa_ c.74.1.1 (A:) automated matches {Escherichia coli [TaxId: 562]} mqnitqswfvqgmikattdawlkgwdernggnltlrlddadiapyhdnfhqqpryiplsq pmpllantpfivtgsgkffrnvqldpmanlgivkvdsdgagyhilwglfneavptselpa hflshcerikatngkdrvimhchatnlialtyvlendtavftrqlwegsteclvvfpdgv gilpwmvpgtdaigqataqemqkhslvlwpfhgvfgsgptldetfglidtaeksaqvlvk vysmggmkqtisreelialgkrfgvtplasalal
Timeline for d2v9oa_: