Lineage for d2v9nc_ (2v9n C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2905490Fold c.74: AraD/HMP-PK domain-like [53638] (1 superfamily)
    3 layers: a/b/a; mixed (mostly antiparallel) beta-sheet of 9 strands, order 432159876; left-handed crossover between strands 4 and 5
  4. 2905491Superfamily c.74.1: AraD/HMP-PK domain-like [53639] (3 families) (S)
  5. 2905492Family c.74.1.1: AraD-like aldolase/epimerase [53640] (5 proteins)
    metal (zinc)-ion dependent
  6. 2905512Protein L-rhamnulose-1-phosphate aldolase [75301] (1 species)
  7. 2905513Species Escherichia coli [TaxId:562] [75302] (8 PDB entries)
  8. 2905518Domain d2v9nc_: 2v9n C: [168404]
    automated match to d1ojra_
    complexed with cit, gol, pgo, po4, zn; mutant

Details for d2v9nc_

PDB Entry: 2v9n (more details), 1.4 Å

PDB Description: l-rhamnulose-1-phosphate aldolase from escherichia coli (mutant a88f- e192a)
PDB Compounds: (C:) rhamnulose-1-phosphate aldolase

SCOPe Domain Sequences for d2v9nc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2v9nc_ c.74.1.1 (C:) L-rhamnulose-1-phosphate aldolase {Escherichia coli [TaxId: 562]}
mqnitqswfvqgmikattdawlkgwdernggnltlrlddadiapyhdnfhqqpryiplsq
pmpllantpfivtgsgkffrnvqldpafnlgivkvdsdgagyhilwgltneavptselpa
hflshcerikatngkdrvimhchatnlialtyvlendtavftrqlwegsteclvvfpdgv
gilpwmvpgtdaigqataqemqkhslvlwpfhgvfgsgptldetfglidtaeksaqvlvk
vysmggmkqtisreelialgkrfgvtplasalal

SCOPe Domain Coordinates for d2v9nc_:

Click to download the PDB-style file with coordinates for d2v9nc_.
(The format of our PDB-style files is described here.)

Timeline for d2v9nc_: