Lineage for d2v9gb_ (2v9g B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2905490Fold c.74: AraD/HMP-PK domain-like [53638] (1 superfamily)
    3 layers: a/b/a; mixed (mostly antiparallel) beta-sheet of 9 strands, order 432159876; left-handed crossover between strands 4 and 5
  4. 2905491Superfamily c.74.1: AraD/HMP-PK domain-like [53639] (3 families) (S)
  5. 2905492Family c.74.1.1: AraD-like aldolase/epimerase [53640] (5 proteins)
    metal (zinc)-ion dependent
  6. 2905567Protein automated matches [190894] (1 species)
    not a true protein
  7. 2905568Species Escherichia coli [TaxId:562] [188311] (7 PDB entries)
  8. 2905579Domain d2v9gb_: 2v9g B: [168394]
    automated match to d1gt7a_
    complexed with tla, zn; mutant

Details for d2v9gb_

PDB Entry: 2v9g (more details), 2.7 Å

PDB Description: l-rhamnulose-1-phosphate aldolase from escherichia coli (mutant q6y- l84w-e192a)
PDB Compounds: (B:) rhamnulose-1-phosphate aldolase

SCOPe Domain Sequences for d2v9gb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2v9gb_ c.74.1.1 (B:) automated matches {Escherichia coli [TaxId: 562]}
mqnityswfvqgmikattdawlkgwdernggnltlrlddadiapyhdnfhqqpryiplsq
pmpllantpfivtgsgkffrnvqwdpaanlgivkvdsdgagyhilwgltneavptselpa
hflshcerikatngkdrvimhchatnlialtyvlendtavftrqlwegsteclvvfpdgv
gilpwmvpgtdaigqataqemqkhslvlwpfhgvfgsgptldetfglidtaeksaqvlvk
vysmggmkqtisreelialgkrfgvtplasalal

SCOPe Domain Coordinates for d2v9gb_:

Click to download the PDB-style file with coordinates for d2v9gb_.
(The format of our PDB-style files is described here.)

Timeline for d2v9gb_: